PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00102.1.g01420.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 1226aa    MW: 134014 Da    PI: 11.7632
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00102.1.g01420.1.am.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_128.33.8e-0910851143563
                                    CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1    5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63  
                                    kr +r   NR +A rs +R+  +i+eLe+kv+ L++e ++L  +l  l+  +a l +++
  Zjn_sc00102.1.g01420.1.am.mk 1085 KRVKRVLANRQSAARSKERRMRYIAELEQKVQILQTEATTLSAQLTLLQRDSAGLATQN 1143
                                    899*********************************************99998887766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.7E-1610811145IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.69110831146IPR004827Basic-leucine zipper domain
PfamPF001701.4E-810851143IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.9E-1010851142No hitNo description
SuperFamilySSF579594.92E-1010851136No hitNo description
CDDcd147033.06E-2210861137No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 1226 aa     Download sequence    Send to blast
MIKTDAAYFN RRVIEQRKAA SWSRLIAPPV DHHLSPCIML RSARDGGSGG TAPCMHALQF  60
SEVGRRSRRR GADVDVYTSR RRRCGHVRLP VPRRIHRRLA GAFQMLARGS LPGVRPAHVG  120
PIARPPPSPG GRRACDRPAK AGKRSSRSIA RGTSSFCSPL YSLMTNGSPF HRCPFRSVRK  180
ERRVISSKSV WKKKKKILGV SGKKVEGPAG RLQLVAHTPY HVTLGQAEPA FLSGDGVPTL  240
RRSFAAAHDA LGCRDSRPAN RCQPKPHGSR LGRARARGSP IELDRSVRGL ITCRMIAPRS  300
GPCRHHGFGS SIGARPPHVR AVQSPPSHRA SWRWIRMIWL ASSMARPARS GDDRLLIGQK  360
AAAVVWWWSP VVSTCARVNQ PIRFGRRARA EGQHAMWFAS MATGDLSTDP ATAERRERQA  420
PRRDSLIDRS ESPSRGHVGV PAPVRRVVVL DFMTTADLTV RRAYVRAHRR LRRASVPVPP  480
GRITNGLWRG RSSLRTPAGS GIDLAVRRPR LDPWQRLPPP FAAAFVRCAV SHPVVRGDDV  540
SRTRSGNLKV CLRCTQFGHG RRACRARKLS TRTPVRGAAL LRPMGERVNK LEYYAPFVPK  600
EVAYVFNWLP LHCSSSSKNQ SVASKTRGLH TVSQRRFQSS LFQPQYYTPH LPFRHPLVSC  660
RFGSLRPSLS SPAHGPPAQV ARTTYSHSLP VQFQTGSERT PREVNGDDSH PTCSSRTPCG  720
PVPGREPRVL EPGFLTVSNR SALHFTISLS RSPIDRRAFR KRDDSEAAAA REGKGARTVH  780
PRLGCWDHPS PSVIPSRERA IDTTPSAPTT PPPPPPPPHQ TIHHAGSLAR ARKRNTVPAS  840
EMNGAANGHG LVPHHHHHHP AQASAPFAAQ HQGSGGGRQL AGLPPTPPGS HAAHADAQGG  900
GGLPPRKAHR RSRSDVPFGY FPPPSPKTEA SGGGWGLPVS GGGGDDLFNA YMSMDGVDAG  960
LRYGSDADSL GSSMRTNGAD SSENESEDYG GGADSQFLVW GDAAGKKSRE GGKRNGAREP  1020
AAAPAGRGHA RSLSMDSLIG KLSFSANGEP GKFSLDFGGG EFTPAEMKRI MADEKLAEMA  1080
LADPKRVKRV LANRQSAARS KERRMRYIAE LEQKVQILQT EATTLSAQLT LLQRDSAGLA  1140
TQNNELKFRL QAMEQQAQLR DALNEALTAE VQRLKVGDAS SSSNLPQQMQ LHCQSQMQEV  1200
HKQQQGEQIP FYQLEQREVA RNHEAK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16782RRRGADVDVYTSRRRR
2191203KKKKKILGVSGKK
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.33e-57bZIP family protein